PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P06480_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 166aa    MW: 19334.9 Da    PI: 8.0618
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P06480_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-1967120356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+ +++keq + Lee F+++++++ +++e LA+kl+L  rqV vWFqNrRa+ k
  GSMUA_Achr4P06480_001  67 KKLRLSKEQSRLLEESFRQHHTLNPKQKEALAMKLKLRPRQVEVWFQNRRARTK 120
                            67789***********************************************98 PP

2HD-ZIP_I/II1246.8e-4067155291
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kk+rlskeq++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E+++e+Lkr++ +l+een+rL++eveeLr 
  GSMUA_Achr4P06480_001  67 KKLRLSKEQSRLLEESFRQHHTLNPKQKEALAMKLKLRPRQVEVWFQNRRARTKLKQTEMECEYLKRCFGSLTEENRRLQREVEELR- 153
                            9*************************************************************************************9. PP

            HD-ZIP_I/II  90 el 91 
                            +l
  GSMUA_Achr4P06480_001 154 AL 155
                            44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-1850123IPR009057Homeodomain-like
SuperFamilySSF466892.09E-1957123IPR009057Homeodomain-like
PROSITE profilePS5007116.95762122IPR001356Homeobox domain
SMARTSM003895.3E-1664126IPR001356Homeobox domain
CDDcd000862.31E-1465123No hitNo description
PfamPF000462.1E-1667120IPR001356Homeobox domain
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
SMARTSM003401.9E-17122165IPR003106Leucine zipper, homeobox-associated
PfamPF021834.1E-10122155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGDLGRSPAE LDLTIGVPGL ISSSPIRGGG CNMRDLDINQ PAYGGEEEYP MASIEEEEEE  60
GGNPRPKKLR LSKEQSRLLE ESFRQHHTLN PKQKEALAMK LKLRPRQVEV WFQNRRARTK  120
LKQTEMECEY LKRCFGSLTE ENRRLQREVE ELRALREKVH RNYVEN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457273e-57AF145727.1 Oryza sativa homeodomain leucine zipper protein (Oshox3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395544.11e-103PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ0JKX12e-75HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH382e-75HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLM0SLL51e-119M0SLL5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P06480_0011e-118(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.17e-55homeobox-leucine zipper protein 17